Recombinant Rat Vesicle-fusing ATPase (Nsf), partial

Product Description

Recombinant Rat Vesicle-fusing ATPase (Nsf), partial is available at Gentaur for Next week Delivery.

Gene Name: Nsf

Alternative Names : N-ethylmaleimide-sensitive fusion protein;NEM-sensitive fusion proteinVesicular-fusion protein NSF

Expression Region : 7-209aa

AA Sequence : QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Ses to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 mbrane cycling.

Function : Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : AAA ATPase family

Tissue Specificity : Detected in brain (at protein level).

Paythway :

Uniprot ID : Q9QUL6