Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial

Product Description

Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial is available at Gentaur for Next week Delivery.

Gene Name: Slc39a13

Alternative Names : Solute carrier family 39 member 13Zrt- and Irt-like protein 13;ZIP-13

Expression Region : 130-233aa

AA Sequence : WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-GST-tagged

Theoretical MW : 41.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a zinc-influx transporter.

Function : Acts as a zinc-influx transporter.

Involvement in disease :

Subcellular location : Golgi apparatus membrane, Multi-pass membrane protein

Protein Families : ZIP transporter (TC 2.A.5) family

Tissue Specificity :

Paythway :

Uniprot ID : Q2M1K6