Recombinant Rhizobium leguminosarum Nitrogenase iron protein (nifH)

Product Description

Recombinant Rhizobium leguminosarum Nitrogenase iron protein (nifH) is available at Gentaur for Next week Delivery.

Gene Name: nifH

Alternative Names : Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase

Expression Region : 1-47aa

AA Sequence : MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Theoretical MW : 35 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.

Function : The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components

Involvement in disease :

Subcellular location :

Protein Families : NifH/BchL/ChlL family

Tissue Specificity :

Paythway :

Uniprot ID : P20623