Product Description
Recombinant Rhizobium meliloti UDP-glucuronate 5'-epimerase (lspL) is available at Gentaur for Next week Delivery.
Gene Name: lspL
Alternative Names : UDP-glucuronic acid epimerase
Expression Region : 1-341aa
AA Sequence : MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNGRPIDIYGEGRMSRDFTYIDDLVESIVRLSHVPPSEENRVAPEKATDTLSRHAPFRVVNTGGGQPVELMTFVETVEKAVGRPAIHNMLPMQQGDVPRTFASPDLLEALTGFKPSVSVEEGVARFVEWYDQNYRRAHTTV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 54.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : UDP-glucuronate = UDP-L-iduronate
Function :
Involvement in disease :
Subcellular location :
Protein Families : NAD(P)-dependent epimerase/dehydratase family
Tissue Specificity :
Paythway :
Uniprot ID : O54067
Euro
British Pound
US Dollar