Product Description
Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1) is available at Gentaur for Next week Delivery.
Gene Name: DOG1
Alternative Names :
Expression Region : 1-246aa
AA Sequence : MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 29.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Active on 2-DOG-6P, also very active on fructose-1P.
Function : Active on 2-DOG-6P, also very active on fructose-1P.
Involvement in disease :
Subcellular location :
Protein Families : HAD-like hydrolase superfamily, DOG/GPP family
Tissue Specificity :
Paythway :
Uniprot ID : P38774
Euro
British Pound
US Dollar