Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1)

Product Description

Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1) is available at Gentaur for Next week Delivery.

Gene Name: DOG1

Alternative Names :

Expression Region : 1-246aa

AA Sequence : MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 29.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Active on 2-DOG-6P, also very active on fructose-1P.

Function : Active on 2-DOG-6P, also very active on fructose-1P.

Involvement in disease :

Subcellular location :

Protein Families : HAD-like hydrolase superfamily, DOG/GPP family

Tissue Specificity :

Paythway :

Uniprot ID : P38774