Recombinant Saccharomyces cerevisiae 26S proteasome regulatory subunit RPN13 (RPN13)

Product Description

Recombinant Saccharomyces cerevisiae 26S proteasome regulatory subunit RPN13 (RPN13) is available at Gentaur for Next week Delivery.

Gene Name: RPN13

Alternative Names : Proteasome non-ATPase subunit 13

Expression Region : 2-156aa

AA Sequence : SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins.

Function : Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : RPN13 family

Tissue Specificity :

Paythway :

Uniprot ID : O13563