Recombinant Saccharomyces cerevisiae Chitin synthase 1 (CHS1), partial

Product Description

Recombinant Saccharomyces cerevisiae Chitin synthase 1 (CHS1), partial is available at Gentaur for Next week Delivery.

Gene Name: CHS1

Alternative Names : Chitin-UDP acetyl-glucosaminyl transferase 1

Expression Region : 4-200aa

AA Sequence : QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Septum formation and repair, especially under certain adverse conditions.

Function : Septum formation and repair, especially under certain adverse conditions.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : Chitin synthase family

Tissue Specificity :

Paythway :

Uniprot ID : P08004