Euro
British Pound
US Dollar
Product Description
Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1) is available at Gentaur for Next week Delivery.
Gene Name: GSP1
Alternative Names : Chromosome stability protein 17 GTPase Ran homolog Genetic suppressor of PRP20-1
Expression Region : 2-219aa
AA Sequence : SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 26.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : GTP-binding protein involved in nucleoCytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Function : GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : Small GTPase superfamily, Ran family
Tissue Specificity :
Paythway :
Uniprot ID : P32835
