Product Description
Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial is available at Gentaur for Next week Delivery.
Gene Name: AUR1
Alternative Names : Aureobasidin A resistance protein Phosphatidylinositol:ceramide phosphoinositol transferase
Expression Region : 313-401aa
AA Sequence : TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA
Sequence Info : Partial
Tag Info : N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Theoretical MW : 26.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.
Function : Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.
Involvement in disease :
Subcellular location : Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein
Protein Families : AUR1 family
Tissue Specificity :
Paythway :
Uniprot ID : P36107
Euro
British Pound
US Dollar