Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial

Product Description

Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1 (AUR1), partial is available at Gentaur for Next week Delivery.

Gene Name: AUR1

Alternative Names : Aureobasidin A resistance protein Phosphatidylinositol:ceramide phosphoinositol transferase

Expression Region : 313-401aa

AA Sequence : TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA

Sequence Info : Partial

Tag Info : N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Theoretical MW : 26.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.

Function : Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.

Involvement in disease :

Subcellular location : Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein

Protein Families : AUR1 family

Tissue Specificity :

Paythway :

Uniprot ID : P36107