Product Description
Recombinant Saccharomyces cerevisiae Neutral trehalase (NTH1), partial is available at Gentaur for Next week Delivery.
Gene Name: NTH1
Alternative Names : Alpha,alpha-trehalaseAlpha,alpha-trehalose glucohydrolase
Expression Region : 3-221aa
AA Sequence : QVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQKQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDKTLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAKSFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Glycosyl hydrolase 37 family
Tissue Specificity :
Paythway :
Uniprot ID : P32356