Euro
British Pound
US Dollar
Product Description
Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3 (SMT3) is available at Gentaur for Next week Delivery.
Gene Name: SMT3
Alternative Names :
Expression Region : 2-98aa
AA Sequence : SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Not known; suppressor of MIF2 mutations.
Function : Not known; suppressor of MIF2 mutations.
Involvement in disease :
Subcellular location :
Protein Families : Ubiquitin family, SUMO subfamily
Tissue Specificity :
Paythway :
Uniprot ID : Q12306
