Product Description
Recombinant Saccharum officinarum Sucrose synthase (SUS1), partial is available at Gentaur for Next week Delivery.
Gene Name: SUS1
Alternative Names : Sucrose-UDP glucosyltransferase
Expression Region : 1-218aa
AA Sequence : ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 41.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.
Function : Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.
Involvement in disease :
Subcellular location :
Protein Families : Glycosyltransferase 1 family, Plant sucrose synthase subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P31925
Euro
British Pound
US Dollar