Euro
British Pound
US Dollar
Product Description
Recombinant Salmonella typhi LPS-assembly protein LptD (lptD), partial is available at Gentaur for Next week Delivery.
Gene Name: lptD
Alternative Names :
Expression Region : 73-169aa
AA Sequence : VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.
Function : Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.
Involvement in disease :
Subcellular location : Cell outer membrane
Protein Families : LptD family
Tissue Specificity :
Paythway :
Uniprot ID : Q8Z9J6
