Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)

Product Description

Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5) is available at Gentaur for Next week Delivery.

Gene Name: mas5

Alternative Names :

Expression Region : 1-404aa

AA Sequence : MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 51.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probably involved in mitochondrial protein import. Plays a role in microtubule cytoskeleton organization.

Function : Probably involved in mitochondrial protein import (By similarity). Plays a role in microtubule cytoskeleton organization.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : O74752