Recombinant Serratia marcescens Metallo-beta-lactamase type 2, partial

Product Description

Recombinant Serratia marcescens Metallo-beta-lactamase type 2, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : B2 metallo-beta-lactamaseCurated BLA-IMP

Expression Region : 20-246aa

AA Sequence : ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN

Sequence Info : Partial

Tag Info : N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 45 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.

Function : Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.

Involvement in disease :

Subcellular location : Periplasm

Protein Families : Metallo-beta-lactamase superfamily, Class-B beta-lactamase family

Tissue Specificity :

Paythway :

Uniprot ID : P52699