Product Description
Recombinant Serratia marcescens Metallo-beta-lactamase type 2, partial is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : B2 metallo-beta-lactamaseCurated BLA-IMP
Expression Region : 20-246aa
AA Sequence : ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN
Sequence Info : Partial
Tag Info : N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 45 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.
Function : Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring.
Involvement in disease :
Subcellular location : Periplasm
Protein Families : Metallo-beta-lactamase superfamily, Class-B beta-lactamase family
Tissue Specificity :
Paythway :
Uniprot ID : P52699
Euro
British Pound
US Dollar