Product Description
Recombinant Sheep Protransforming growth factor alpha (TGFA), partial is available at Gentaur for Next week Delivery.
Gene Name: TGFA
Alternative Names : EGF-like TGF Short name: ETGF TGF type 1
Expression Region : 24-97aa
AA Sequence : ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Sequence Info : Extracellular Domain
Tag Info : N-terminal GST-tagged
Theoretical MW : 34.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar
Function : TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Involvement in disease :
Subcellular location : Transforming growth factor alpha: Secreted, extracellular space, SUBCELLULAR LOCATION: Protransforming growth factor alpha: Cell membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Skin.
Paythway :
Uniprot ID : P98135
Euro
British Pound
US Dollar