Recombinant Sheep Somatoliberin (GHRH)

Product Description

Recombinant Sheep Somatoliberin (GHRH) is available at Gentaur for Next week Delivery.

Gene Name: GHRH

Alternative Names : Growth hormone-releasing factor;GRFGrowth hormone-releasing hormone;GHRH

Expression Region : 1-44aa

AA Sequence : YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 32.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Function : GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glucagon family

Tissue Specificity :

Paythway :

Uniprot ID : P07217