Recombinant Shigella flexneri Adenylate kinase (adk)

Product Description

Recombinant Shigella flexneri Adenylate kinase (adk) is available at Gentaur for Next week Delivery.

Gene Name: adk

Alternative Names : ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase

Expression Region : 1-214aa

AA Sequence : MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 43.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Function : Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Adenylate kinase family

Tissue Specificity :

Paythway :

Uniprot ID : Q83M40