Euro
British Pound
US Dollar
Product Description
Recombinant Spinacia oleracea Plastocyanin,chloroplastic (PETE), partial is available at Gentaur for Next week Delivery.
Gene Name: PETE
Alternative Names :
Expression Region : 70-168aa
AA Sequence : VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 26.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Function : Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Involvement in disease :
Subcellular location : Plastid, chloroplast thylakoid membrane, Peripheral membrane protein, Lumenal side
Protein Families : Plastocyanin family
Tissue Specificity :
Paythway :
Uniprot ID : P00289
