Recombinant Staphylococcus aureus Tetracycline resistance protein tetM (tetM), partial

Product Description

Recombinant Staphylococcus aureus Tetracycline resistance protein tetM (tetM), partial is available at Gentaur for Next week Delivery.

Gene Name: tetM

Alternative Names : tetA(M)

Expression Region : 1-242aa

AA Sequence : MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 32.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.

Function : Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.

Involvement in disease :

Subcellular location :

Protein Families : TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, TetM/TetO subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q53770