Euro
British Pound
US Dollar
Product Description
Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst) is available at Gentaur for Next week Delivery.
Gene Name: tst
Alternative Names : TSST-1
Expression Region : 41-234aa
AA Sequence : STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 37.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Responsible for the symptoms of toxic shock syndrome.
Function : Responsible for the symptoms of toxic shock syndrome.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Staphylococcal/streptococcal toxin family
Tissue Specificity :
Paythway :
Uniprot ID : P06886
