Recombinant Streptomyces achromogenes Modification methylase SacI (sacIM)

Product Description

Recombinant Streptomyces achromogenes Modification methylase SacI (sacIM) is available at Gentaur for Next week Delivery.

Gene Name: sacIM

Alternative Names : Cytosine-specific methyltransferase SacI

Expression Region : 1-390aa

AA Sequence : MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 59.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.

Function : This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.

Involvement in disease :

Subcellular location :

Protein Families : Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family

Tissue Specificity :

Paythway :

Uniprot ID : O31073