Product Description
Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase (pat) is available at Gentaur for Next week Delivery.
Gene Name: pat
Alternative Names : PPT N-acetyltransferase;Phosphinothricin-resistance protein
Expression Region : 1-183aa
AA Sequence : MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Streptomyces viridochromogenes
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Function : Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Involvement in disease :
Subcellular location :
Protein Families : Acetyltransferase family, PAT/BAR subfamily
Tissue Specificity :
Paythway :
Uniprot ID : Q57146
Euro
British Pound
US Dollar