Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase (pat)

Product Description

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase (pat) is available at Gentaur for Next week Delivery.

Gene Name: pat

Alternative Names : PPT N-acetyltransferase;Phosphinothricin-resistance protein

Expression Region : 1-183aa

AA Sequence : MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Streptomyces viridochromogenes

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.

Function : Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.

Involvement in disease :

Subcellular location :

Protein Families : Acetyltransferase family, PAT/BAR subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q57146