Recombinant Streptomyces viridosporus Probable hydrogen peroxide-inducible genes activator (oxyR)

Product Description

Recombinant Streptomyces viridosporus Probable hydrogen peroxide-inducible genes activator (oxyR) is available at Gentaur for Next week Delivery.

Gene Name: oxyR

Alternative Names :

Expression Region : 1-312aa

AA Sequence : MRKRRRQPSLAQLRAFAAVAEHLHFRDAAAAIGMSQPALSGAVSALEESLGVTLLERTTRKVLLSPAGERLAARAKSVLAEVGALVEEADALQAPFTGVLRLGVIPTVAPYVLPTVLRLVHDRYPRLDLQVHEEQTASLLDGLTGGRLDLLLLAVPLGVPGVVELPLFDEDFVLVTPLEHGLGGREGIPRKALRELNLLLLDEGHCLRDQALDICREAGSAGVAATTTAAGLSTLVQLVAGGLGVTLLPHTAVQVETTRSGRLLTGRFADPAPGRRIALAMRTGAARAAEYEELAAALREAMRDLPVRIVRD

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 40.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for the induction of a regulon of hydrogen peroxide inducible genes such as catalase and glutathione-reductase.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9X5P2