Recombinant Synsepalum dulcificum Miraculin

Product Description

Recombinant Synsepalum dulcificum Miraculin is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 30-220aa

AA Sequence : DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 23.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Function : Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Involvement in disease :

Subcellular location :

Protein Families : Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family

Tissue Specificity : Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.

Paythway :

Uniprot ID : P13087