Recombinant Theragra chalcogramma Parvalbumin beta-1

Product Description

Recombinant Theragra chalcogramma Parvalbumin beta-1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Allergen: The c 1

Expression Region : 2-109aa

AA Sequence : SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

Theoretical MW : 31.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity).

Function : In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity).

Involvement in disease :

Subcellular location :

Protein Families : Parvalbumin family

Tissue Specificity :

Paythway :

Uniprot ID : Q90YK8