Recombinant Treponema pallidum 34 kDa membrane antigen (tpd)

Product Description

Recombinant Treponema pallidum 34 kDa membrane antigen (tpd) is available at Gentaur for Next week Delivery.

Gene Name: tpd

Alternative Names : Pathogen-specific membrane antigen

Expression Region : 20-204aa

AA Sequence : CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 27.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This antigen is a pathogen-specific membrane immunogen.

Function : This antigen is a pathogen-specific membrane immunogen.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor

Protein Families : UPF0423 family

Tissue Specificity :

Paythway :

Uniprot ID : P19478