Product Description
Recombinant Treponema pallidum 34 kDa membrane antigen (tpd) is available at Gentaur for Next week Delivery.
Gene Name: tpd
Alternative Names : Pathogen-specific membrane antigen
Expression Region : 20-204aa
AA Sequence : CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 27.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This antigen is a pathogen-specific membrane immunogen.
Function : This antigen is a pathogen-specific membrane immunogen.
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor
Protein Families : UPF0423 family
Tissue Specificity :
Paythway :
Uniprot ID : P19478
Euro
British Pound
US Dollar