Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C

Product Description

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : rRNA N-glycosidase Cleaved into the following chain: Ribosome-inactivating protein karasurin-A

Expression Region : 22-270aa

AA Sequence : EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 29.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Function : Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Involvement in disease :

Subcellular location :

Protein Families : Ribosome-inactivating protein family, Type 1 RIP subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P24478