Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11)

Product Description

Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11) is available at Gentaur for Next week Delivery.

Gene Name: KMP-11

Alternative Names : KMP11

Expression Region : 1-92aa

AA Sequence : MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 18.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Function : May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton

Protein Families : KMP-11 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9U6Z1