Recombinant Ustilago maydis P6 virus KP6 killer toxin, partial

Product Description

Recombinant Ustilago maydis P6 virus KP6 killer toxin, partial is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 28-105aa

AA Sequence : NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 10.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Function : This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P16948