Product Description
Recombinant Vaccinia virus Protein A33 (VACWR156), partial is available at Gentaur for Next week Delivery.
Gene Name: VACWR156
Alternative Names :
Expression Region : 57-185aa
AA Sequence : VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Coordinates the incorporation of A36 into wrapped enveloped virion membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles.
Function : Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles.
Involvement in disease :
Subcellular location : Virion membrane, Single-pass type II membrane protein, Host membrane, Single-pass type II membrane protein
Protein Families : Chordopoxvirinae A33 protein family
Tissue Specificity :
Paythway :
Uniprot ID : P68617