Recombinant Vaccinia virus Protein B5 (PS/HR), partial

Product Description

Recombinant Vaccinia virus Protein B5 (PS/HR), partial is available at Gentaur for Next week Delivery.

Gene Name: PS/HR

Alternative Names : Plaque-size/host range protein

Expression Region : 18-279aa

AA Sequence : YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 36.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions to form intracellular enveloped virions.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P21115