Recombinant Vaccinia virus Protein E3 (E3L)

Product Description

Recombinant Vaccinia virus Protein E3 (E3L) is available at Gentaur for Next week Delivery.

Gene Name: E3L

Alternative Names : p25

Expression Region : 1-190aa

AA Sequence : MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 28.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein

Function : The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein (By similarity).

Involvement in disease :

Subcellular location :

Protein Families : Poxviridae E3 protein family

Tissue Specificity :

Paythway :

Uniprot ID : P21081