Product Description
Recombinant Vaccinia virus Protein I5 (VACWR074) is available at Gentaur for Next week Delivery.
Gene Name: VACWR074
Alternative Names : Protein VP13K
Expression Region : 2-79aa
AA Sequence : VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Envelope protein
Function : Envelope protein.
Involvement in disease :
Subcellular location : Virion membrane, Multi-pass membrane protein
Protein Families : Chordopoxvirinae I5 family
Tissue Specificity :
Paythway :
Uniprot ID : P12924
Euro
British Pound
US Dollar