Product Description
Recombinant Vaccinia virus Protein K3 (VACWR034) is available at Gentaur for Next week Delivery.
Gene Name: VACWR034
Alternative Names : Protein K2
Expression Region : 1-88aa
AA Sequence : MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Function : Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Involvement in disease :
Subcellular location :
Protein Families : Poxviridae K3 protein family
Tissue Specificity :
Paythway :
Uniprot ID : P18378
Euro
British Pound
US Dollar