Recombinant Vaccinia virus Protein L1 (VACWR088), partial

Product Description

Recombinant Vaccinia virus Protein L1 (VACWR088), partial is available at Gentaur for Next week Delivery.

Gene Name: VACWR088

Alternative Names : Virion membrane protein M25

Expression Region : 2-183aa

AA Sequence : GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.

Function : Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.

Involvement in disease :

Subcellular location : Virion membrane, Single-pass membrane protein

Protein Families : Chordopoxvirinae L1 family

Tissue Specificity :

Paythway :

Uniprot ID : P07612