Product Description
Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Toxin Vm24 Toxin alpha-KTx 21.1
Expression Region : 1-36aa
AA Sequence : AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 7.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice.
Function : Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 ug) produce no symptoms of intoxication when injected into mice.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Short scorpion toxin superfamily, Potassium channel inhibitor family, Alpha-KTx 23 subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P0DJ31
Euro
British Pound
US Dollar