Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1

Product Description

Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Toxin Vm24 Toxin alpha-KTx 21.1

Expression Region : 1-36aa

AA Sequence : AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 7.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice.

Function : Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 ug) produce no symptoms of intoxication when injected into mice.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Short scorpion toxin superfamily, Potassium channel inhibitor family, Alpha-KTx 23 subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P0DJ31