Product Description
Recombinant White-rot fungus Cellobiose dehydrogenase (CDH-1), partial is available at Gentaur for Next week Delivery.
Gene Name: CDH-1
Alternative Names : Cellobiose-quinone oxidoreductase
Expression Region : 19-208aa
AA Sequence : QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
Function : Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
Involvement in disease :
Subcellular location : Secreted
Protein Families : GMC oxidoreductase family
Tissue Specificity :
Paythway :
Uniprot ID : Q01738
Euro
British Pound
US Dollar