Recombinant Zea mays Auxin-binding protein 1 (ABP1)

Product Description

Recombinant Zea mays Auxin-binding protein 1 (ABP1) is available at Gentaur for Next week Delivery.

Gene Name: ABP1

Alternative Names : ERABP1

Expression Region : 39-201aa

AA Sequence : SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is probably a receptor for the plant hormone auxin.

Function : Receptor for the plant hormone auxin.

Involvement in disease :

Subcellular location : Endoplasmic reticulum lumen

Protein Families :

Tissue Specificity : Expressed in roots, coleoptiles, leaves, stems, tassels and ears.

Paythway :

Uniprot ID : P13689