Product Description
Recombinant Zea mays Auxin-binding protein 1 (ABP1) is available at Gentaur for Next week Delivery.
Gene Name: ABP1
Alternative Names : ERABP1
Expression Region : 39-201aa
AA Sequence : SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is probably a receptor for the plant hormone auxin.
Function : Receptor for the plant hormone auxin.
Involvement in disease :
Subcellular location : Endoplasmic reticulum lumen
Protein Families :
Tissue Specificity : Expressed in roots, coleoptiles, leaves, stems, tassels and ears.
Paythway :
Uniprot ID : P13689
Euro
British Pound
US Dollar