Product Description
Recombinant Zoarces americanus Ice-structuring protein lambda OP-3 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Antifreeze protein lambda OP-3
Expression Region : 23-91aa
AA Sequence : NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 11.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).
Function : Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Type-III AFP family
Tissue Specificity :
Paythway :
Uniprot ID : P19606
Euro
British Pound
US Dollar