Recombinant Zoarces americanus Ice-structuring protein lambda OP-3

Product Description

Recombinant Zoarces americanus Ice-structuring protein lambda OP-3 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Antifreeze protein lambda OP-3

Expression Region : 23-91aa

AA Sequence : NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).

Function : Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : Type-III AFP family

Tissue Specificity :

Paythway :

Uniprot ID : P19606