Product Description
RecombinantMouseAquaporin-4 (Aqp4), partial is available at Gentaur for Next week Delivery.
Gene Name: Aqp4
Alternative Names : Mercurial-insensitive water channel
Expression Region : 253-323aa
AA Sequence : CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Function : Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : MIP/aquaporin (TC 1.A.8) family
Tissue Specificity :
Paythway :
Uniprot ID : P55088
Euro
British Pound
US Dollar