RecombinantMouseAquaporin-4 (Aqp4), partial

Product Description

RecombinantMouseAquaporin-4 (Aqp4), partial is available at Gentaur for Next week Delivery.

Gene Name: Aqp4

Alternative Names : Mercurial-insensitive water channel

Expression Region : 253-323aa

AA Sequence : CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Function : Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : MIP/aquaporin (TC 1.A.8) family

Tissue Specificity :

Paythway :

Uniprot ID : P55088