Recombinant Proteins

Recombinant Growth Differentiation Factor 10 (GDF10)

Recombinant Growth Differentiation Factor 10 (GDF10) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 10 Alternative Names : BMP3b; BIP; Bone-inducing protein; Bone morphogenetic protein 3B Expression Region :...

Recombinant Growth Differentiation Factor 1 (GDF1)

Recombinant Growth Differentiation Factor 1 (GDF1) is available at Gentaur for Next week Delivery. Gene Name: Growth Differentiation Factor 1 Alternative Names : Embryonic growth/differentiation factor 1 Expression Region : Leu183~Arg357 (Accession #...

Recombinant Growth Associated Protein 43 (GAP43)

Recombinant Growth Associated Protein 43 (GAP43) is available at Gentaur for Next week Delivery. Gene Name: Growth Associated Protein 43 Alternative Names : F1; B-50; PP46; Neuron Growth-Associated Protein 43; Neuromodulin; Axonal Membrane Protein...

Recombinant Growth Arrest Specific Protein 6 (GAS6)

Recombinant Growth Arrest Specific Protein 6 (GAS6) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 6 Alternative Names : AXLLG; AXSF; AXL Stimulatory Factor; AXL receptor tyrosine kinase ligand Expression Region...

Recombinant Growth Arrest Specific Protein 2 (GAS2)

Recombinant Growth Arrest Specific Protein 2 (GAS2) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest Specific Protein 2 Alternative Names : Expression Region : Gly64~Asp267 (Accession # O43903) AA Sequence : Sequence Info : Tag...

Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g)

Recombinant Growth Arrest And DNA Damage Inducible Protein Gamma (GADD45g) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Gamma Alternative Names : CR6; DDIT2; GADD45gamma; GRP17; Gadd-Related...

Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b)

Recombinant Growth Arrest And DNA Damage Inducible Protein Beta (GADD45b) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Beta Alternative Names : GADD45BETA; MYD118; Myeloid differentiation...

Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a)

Recombinant Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) is available at Gentaur for Next week Delivery. Gene Name: Growth Arrest And DNA Damage Inducible Protein Alpha Alternative Names : DDIT1; GADD45; DNA damage-inducible transcript...

Recombinant Gremlin 2 (GREM2)

Recombinant Gremlin 2 (GREM2) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 2 Alternative Names : Prdc; CKTSF1B2; DAND3; Cysteine Knot Superfamily,Homolog; Protein Related To DAN And Cerberus; DAN domain family member 3 Expression...

Recombinant Gremlin 1 (GREM1)

Recombinant Gremlin 1 (GREM1) is available at Gentaur for Next week Delivery. Gene Name: Gremlin 1 Alternative Names : PIG2; CKTSF1B1; DAND2; IHG-2; DAND2; DRM; Increased in high glucose protein 2; Cell proliferation-inducing gene 2 protein; Cysteine...

Recombinant Green Fluorescent Protein (GFP)

Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery. Gene Name: Green Fluorescent Protein Alternative Names : Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag AA Sequence :...

Recombinant GRB2 Related Adaptor Protein 2 (GRAP2)

Recombinant GRB2 Related Adaptor Protein 2 (GRAP2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Related Adaptor Protein 2 Alternative Names : P38; GADS; GRAP-2; GRB2L; GRBLG; GRID; GRPL; GrbX; Grf40; Mona; Growth factor...

Recombinant GRB2 Associated Binding Protein 3 (GAB3)

Recombinant GRB2 Associated Binding Protein 3 (GAB3) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 3 Alternative Names : DOS/Gab Family Member 3; Gab3 Scaffolding Protein; GRB2-associated binder 3; Growth...

Recombinant GRB2 Associated Binding Protein 2 (GAB2)

Recombinant GRB2 Associated Binding Protein 2 (GAB2) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 2 Alternative Names : pp100; GRB2-associated binder 2; Growth factor receptor bound protein 2-associated...

Recombinant GRB2 Associated Binding Protein 1 (GAB1)

Recombinant GRB2 Associated Binding Protein 1 (GAB1) is available at Gentaur for Next week Delivery. Gene Name: GRB2 Associated Binding Protein 1 Alternative Names : GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1...

Recombinant Granzyme M (GZMM)

Recombinant Granzyme M (GZMM) is available at Gentaur for Next week Delivery. Gene Name: Granzyme M Alternative Names : GZM-M; LMET1; MET1; Hu-Met-1; Met-ase; Lymphocyte Met Ase 1; Met-1 serine protease; Natural killer cell granular protease Expression...

Recombinant Granzyme K (GZMK)

Recombinant Granzyme K (GZMK) is available at Gentaur for Next week Delivery. Gene Name: Granzyme K Alternative Names : GZM-K; TRYP2; PRSS; Serine Protease,Granzyme 3; Tryptase II; Fragmentin-3; Granzyme-3; NK-tryptase-2 Expression Region : Gln44~Val227...

Recombinant Granzyme H (GZMH)

Recombinant Granzyme H (GZMH) is available at Gentaur for Next week Delivery. Gene Name: Granzyme H Alternative Names : CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2; Cathepsin G-Like 2,Protein h-CCPX; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C...

Recombinant Granzyme D (GZMD)

Recombinant Granzyme D (GZMD) is available at Gentaur for Next week Delivery. Gene Name: Granzyme D Alternative Names : Expression Region : Pro33~Ile245 (Accession # P11033) AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag Theoretical...

Recombinant Granzyme B (GZMB)

Recombinant Granzyme B (GZMB) is available at Gentaur for Next week Delivery. Gene Name: Granzyme B Alternative Names : GZM-B; HLP; CTLA1; CCPI; CGL1; CSP-B; CSPB; CTSGL1; SECT; Granzyme 2; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1; Fragmentin...

Recombinant Granzyme A (GZMA)

Recombinant Granzyme A (GZMA) is available at Gentaur for Next week Delivery. Gene Name: Granzyme A Alternative Names : CTLA3; HFSP; HF; H factor; Granzyme 1; Fragmentin-1; Hanukkah factor; Cytotoxic T-Lymphocyte-Associated Serine Esterase 3; CTL...

Recombinant Granulocyte Chemotactic Protein 2 (GCP2)

Recombinant Granulocyte Chemotactic Protein 2 (GCP2) is available at Gentaur for Next week Delivery. Gene Name: Granulocyte Chemotactic Protein 2 Alternative Names : CXCL6; SCYB6; GCP2; CKA-3; Chemokine(C-X-C-Motif)ligand 6; Small Inducible Cytokine...

Recombinant Granulin (GRN)

Recombinant Granulin (GRN) is available at Gentaur for Next week Delivery. Gene Name: Granulin Alternative Names : GEP; GP88; PCDGF; PEPI; PGRN; Proepithelin; Acrogranin; Glycoprotein of 88 Kda; Paragranulin Expression Region : Cys31~Leu269 (Accession #...

Recombinant Grancalcin (GCA)

Recombinant Grancalcin (GCA) is available at Gentaur for Next week Delivery. Gene Name: Grancalcin Alternative Names : GCL; EF Hand Calcium Binding Protein Expression Region : Gly39~Ile220 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag...

Recombinant Gossypium hirsutum MML3_A12 (MML3)

Recombinant Gossypium hirsutum MML3_A12 (MML3) is available at Gentaur for Next week Delivery. Gene Name: MML3 Alternative Names : Expression Region : 1-367aa AA Sequence :...

Recombinant Gonadotropin Releasing Hormone (GnRH)

Recombinant Gonadotropin Releasing Hormone (GnRH) is available at Gentaur for Next week Delivery. Gene Name: Gonadotropin Releasing Hormone Alternative Names : GNRH1; GRH; LNRH; LHRH; LH-RH I; Luliberin; Luteinizing-Hormone Releasing Hormone;...

Recombinant Golgi Phosphoprotein 2 (GOLPH2)

Recombinant Golgi Phosphoprotein 2 (GOLPH2) is available at Gentaur for Next week Delivery. Gene Name: Golgi Phosphoprotein 2 Alternative Names : GOLM1; GP73; C9orf155; Golgi Membrane Protein 1; Golgi Protein 73 Expression Region : Ser133~Ser379...

Recombinant Golgi Glycoprotein 1 (GLG1)

Recombinant Golgi Glycoprotein 1 (GLG1) is available at Gentaur for Next week Delivery. Gene Name: Golgi Glycoprotein 1 Alternative Names : CFR-1; ESL-1; MG160; Golgi Apparatus Protein 1; E-selectin ligand 1; Cysteine-rich fibroblast growth factor...

Recombinant GM2 Ganglioside Activator (GM2A)

Recombinant GM2 Ganglioside Activator (GM2A) is available at Gentaur for Next week Delivery. Gene Name: GM2 Ganglioside Activator Alternative Names : SAP-3; Cerebroside Sulfate Activator Protein; Sphingolipid Activator Protein 3 Expression Region :...

Recombinant Glypican 5 (GPC5)

Recombinant Glypican 5 (GPC5) is available at Gentaur for Next week Delivery. Gene Name: Glypican 5 Alternative Names : Glypican Proteoglycan 5; Secreted glypican-5 Expression Region : Val27~His241 AA Sequence : Sequence Info : Tag Info : N-terminal His...

Recombinant Glypican 4 (GPC4)

Recombinant Glypican 4 (GPC4) is available at Gentaur for Next week Delivery. Gene Name: Glypican 4 Alternative Names : K-Glypican; Glypican Proteoglycan 4; Secreted glypican-4 Expression Region : Ala222~Leu468 AA Sequence : Sequence Info : Tag Info :...

Recombinant Glypican 3 (GPC3)

Recombinant Glypican 3 (GPC3) is available at Gentaur for Next week Delivery. Gene Name: Glypican 3 Alternative Names : DGSX; OCI5; SDYS; SGB; SGBS1; MXR7; Glypican Proteoglycan 3; GTR2-2; Intestinal protein OCI-5; Secreted glypican-3 Expression Region :...

Recombinant Glypican 1 (GPC1)

Recombinant Glypican 1 (GPC1) is available at Gentaur for Next week Delivery. Gene Name: Glypican 1 Alternative Names : Glypican Proteoglycan 1; Secreted glypican-1 Expression Region : Ala155~Leu292 (Accession # Q9QZF2) AA Sequence : Sequence Info : Tag...

Recombinant Glyoxalase I (GLO1)

Recombinant Glyoxalase I (GLO1) is available at Gentaur for Next week Delivery. Gene Name: Glyoxalase I Alternative Names : GLY-I; GLOD1; Glyoxalase Domain Containing 1; Lactoylglutathione lyase; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase;...

Recombinant Glycyl tRNA Synthetase (GARS)

Recombinant Glycyl tRNA Synthetase (GARS) is available at Gentaur for Next week Delivery. Gene Name: Glycyl tRNA Synthetase Alternative Names : CMT2D; CMT2-D; DSMAV; GlyRS; SMAD1; EJ; Charcot-Marie-Tooth Neuropathy 2D; Glycine tRNA Ligase; Diadenosine...

Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1)

Recombinant Glycosylphosphatidylinositol Specific Phospholipase D1 (GPLD1) is available at Gentaur for Next week Delivery. Gene Name: Glycosylphosphatidylinositol Specific Phospholipase D1 Alternative Names : GPIPLD; GPIPLDM; PIGPLD; PIGPLD1;...

Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML)

Recombinant Glycosylphosphatidylinositol Anchored Molecule Like Protein (GML) is available at Gentaur for Next week Delivery. Gene Name: Glycosylphosphatidylinositol Anchored Molecule Like Protein Alternative Names : LY6DL; GPI Anchored Molecule Like...

Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1)

Recombinant Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 (GPIHBP1) is available at Gentaur for Next week Delivery. Gene Name: Glycosylphosphatidylinositol Anchored High Density Lipoprotein Binding Protein 1 Alternative...

Recombinant Glycosylated Lysosomal Membrane Protein (GLMP)

Recombinant Glycosylated Lysosomal Membrane Protein (GLMP) is available at Gentaur for Next week Delivery. Gene Name: Glycosylated Lysosomal Membrane Protein Alternative Names : C1orf85; NCU-G1; Lysosomal protein NCU-G1 Expression Region : Pro246~Asn404...

Recombinant Glycoprotein VI (GP6)

Recombinant Glycoprotein VI (GP6) is available at Gentaur for Next week Delivery. Gene Name: Glycoprotein VI Alternative Names : GPIV; GP-VI; Glycoprotein VI, Platelet Expression Region : Tyr86~Thr231 AA Sequence : Sequence Info : Tag Info : N-terminal...

Recombinant Glycoprotein IX, Platelet (GP9)

Recombinant Glycoprotein IX, Platelet (GP9) is available at Gentaur for Next week Delivery. Gene Name: Glycoprotein IX, Platelet Alternative Names : CD42-A; CD42a; GPIX; Glycoprotein 9 Expression Region : Met1~Trp161 AA Sequence : Sequence Info : Tag...

Recombinant Glycoprotein A33 (GPA33)

Recombinant Glycoprotein A33 (GPA33) is available at Gentaur for Next week Delivery. Gene Name: Glycoprotein A33 Alternative Names : Cell surface A33 antigen Expression Region : Ile22~Ile235 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag...

Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2)

Recombinant Glycoprotein 2, Zymogen Granule Membrane (GP2) is available at Gentaur for Next week Delivery. Gene Name: Glycoprotein 2, Zymogen Granule Membrane Alternative Names : ZAP75; Pancreatic Secretory Granule Membrane Major Glycoprotein GP2;...

Recombinant Glycoprotein 130 (gp130)

Recombinant Glycoprotein 130 (gp130) is available at Gentaur for Next week Delivery. Gene Name: Glycoprotein 130 Alternative Names : CDw130; CD130; IL6ST; GP130-RAPS; IR6RB; IL6R-Beta; IR6RB; IR6-RB; Interleukin 6 Signal Transducer; Oncostatin M...

Recombinant Glycophorin E (GYPE)

Recombinant Glycophorin E (GYPE) is available at Gentaur for Next week Delivery. Gene Name: Glycophorin E Alternative Names : GYP-E; MNS; GPE; MiIX Expression Region : Ser20~Ile70 AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag...

Recombinant Glycophorin C (GYPC)

Recombinant Glycophorin C (GYPC) is available at Gentaur for Next week Delivery. Gene Name: Glycophorin C Alternative Names : CD236; CD236R; GYP-C; PAS-2; GPC; GYPD; Ge; Glycoprotein Beta; Glycoconnectin; Gerbich Blood Group; Glycophorin-D;...

Recombinant Glycophorin A (GYPA)

Recombinant Glycophorin A (GYPA) is available at Gentaur for Next week Delivery. Gene Name: Glycophorin A Alternative Names : CD235a; MN; MNS; GPA; GPErik; GPSAT; PAS-2; GpMiIII; HGpMiIII; HGpMiV; HGpMiX; HGpMiXI; HGpSta; Sialoglycoprotein alpha; MN...

Recombinant Glycolipid Transfer Protein (GLTP)

Recombinant Glycolipid Transfer Protein (GLTP) is available at Gentaur for Next week Delivery. Gene Name: Glycolipid Transfer Protein Alternative Names : Expression Region : Ala2~Val209 AA Sequence : Sequence Info : Tag Info : N-terminal His and GST Tag...

Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b)

Recombinant Glycogen Synthase Kinase 3 Beta (GSK3b) is available at Gentaur for Next week Delivery. Gene Name: Glycogen Synthase Kinase 3 Beta Alternative Names : Serine/threonine-protein kinase GSK3B Expression Region : Lys122~Thr375 AA Sequence :...

Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a)

Recombinant Glycogen Synthase Kinase 3 Alpha (GSK3a) is available at Gentaur for Next week Delivery. Gene Name: Glycogen Synthase Kinase 3 Alpha Alternative Names : Serine/threonine-protein kinase GSK3A Expression Region : Ile122~Asn416 AA Sequence :...

Recombinant Glycogen Synthase 2, Liver (GYS2)

Recombinant Glycogen Synthase 2, Liver (GYS2) is available at Gentaur for Next week Delivery. Gene Name: Glycogen Synthase 2, Liver Alternative Names : Expression Region : Met1~Val377 AA Sequence : Sequence Info : Tag Info : N-terminal His Tag...

Recombinant Glycogen Phosphorylase, Muscle (PYGM)

Recombinant Glycogen Phosphorylase, Muscle (PYGM) is available at Gentaur for Next week Delivery. Gene Name: Glycogen Phosphorylase, Muscle Alternative Names : GPMM; Phosphorylase,Glycogen; McArdle Syndrome,Glycogen Storage Disease Type V;...