Recombinan Bombyx mori Cecropin-D (CECD)

Product Description

Recombinan Bombyx mori Cecropin-D (CECD) is available at Gentaur for Next week Delivery.

Gene Name: CECD

Alternative Names :

Expression Region : 25-60aa

AA Sequence : GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 7.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Function : Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Cecropin family

Tissue Specificity : Mainly in fat body. Lower in hemocytes. Not expressed in midguts, malpighian tubules and silk glands.

Paythway :

Uniprot ID : O76146