Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7)

Product Description

Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) is available at Gentaur for Next week Delivery.

Gene Name: D7

Alternative Names : Alternative name(s): Protein D7 Allergen: Aed a 2

Expression Region : 18-321aa

AA Sequence : STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Allergen

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thought to be involved in blood-feeding.

Function : Thought to be involved in blood-feeding.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Expressed in the distal-lateral and medial lobes of the adult female salivary gland.

Paythway :

Uniprot ID : P18153