Product Description
Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) is available at Gentaur for Next week Delivery.
Gene Name: D7
Alternative Names : Alternative name(s): Protein D7 Allergen: Aed a 2
Expression Region : 18-321aa
AA Sequence : STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 37.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Allergen
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Thought to be involved in blood-feeding.
Function : Thought to be involved in blood-feeding.
Involvement in disease :
Subcellular location : Secreted
Protein Families :
Tissue Specificity : Expressed in the distal-lateral and medial lobes of the adult female salivary gland.
Paythway :
Uniprot ID : P18153
Euro
British Pound
US Dollar