Product Description
Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5 (DRB5) is available at Gentaur for Next week Delivery.
Gene Name: DRB5
Alternative Names : dsRNA-binding protein 5 Short name: AtDRB5
Expression Region : 1-393aa
AA Sequence : MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 45.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Function : Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : Expressed in the shoot apical meristem (SAM).
Paythway :
Uniprot ID : Q8GY79