Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial

Product Description

Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial is available at Gentaur for Next week Delivery.

Gene Name: APX2

Alternative Names : L-ascorbate peroxidase 1b;APX1b;AtAPx02

Expression Region : 4-250aa

AA Sequence : KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a key role in hydrogen peroxide roval.

Function : Plays a key role in hydrogen peroxide removal.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Peroxidase family, Ascorbate peroxidase subfamily

Tissue Specificity : Detected in bundle sheath cells, the photosynthetic cells that surround the phloem and xylem.

Paythway :

Uniprot ID : Q1PER6