Product Description
Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3 (NFYA3) is available at Gentaur for Next week Delivery.
Gene Name: NFYA3
Alternative Names : Transcriptional activator HAP2;C
Expression Region : 1-340aa
AA Sequence : MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 41.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Function : Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : NFYA/HAP2 subunit family
Tissue Specificity : Ubiquitous.
Paythway :
Uniprot ID : Q93ZH2
Euro
British Pound
US Dollar