Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3 (NFYA3)

Product Description

Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3 (NFYA3) is available at Gentaur for Next week Delivery.

Gene Name: NFYA3

Alternative Names : Transcriptional activator HAP2;C

Expression Region : 1-340aa

AA Sequence : MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 41.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Function : Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : NFYA/HAP2 subunit family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : Q93ZH2