Product Description
Recombinant Bacillus subtilis L-cystine-binding protein tcyA (tcyA) is available at Gentaur for Next week Delivery.
Gene Name: tcyA
Alternative Names :
Expression Region : 20-268aa
AA Sequence : CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 29.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Part of the ABC transporter complex TcyABC involved in L-cystine import.
Function : Part of the ABC transporter complex TcyABC involved in L-cystine import.
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor
Protein Families : Bacterial solute-binding protein 3 family
Tissue Specificity :
Paythway :
Uniprot ID : P42199